Frontiers in glucagon
These peptides , including glucagon , glucagon-like peptide 1 (GLP-1), glucagon-like peptide 2 (GLP-2), and oxyntomodulin, exert diverse effects on several aspects of human physiology , ranging from glucose, lipid, and protein metabolism to appetite regulation, nutrient absorption, and gastrointestinal motility.
Physiology and Pharmacology of the Enteroendocrine Hormone Glucagon ...
Glucagon-like peptide-2 (GLP-2) is a 33-amino-acid proglucagon-derived peptide secreted from enteroendocrine L cells. GLP-2 circulates at low basal levels in the fasting period, and plasma levels rise rapidly after food ingestion. Renal clearance and enzymatic inactivation control the elimination of bioactive GLP-2. GLP-2 increases mesenteric blood flow and activates proabsorptive pathways in ...
This particular example perfectly highlights why Glucagon Like Peptide 2 Physiology is so captivating.
Abstract Glucagon like peptide-2 (GLP-2) is a gastrointestinal hormone released from enteroendocrine L-type cells together with glucagon like peptide-1 in response to dietary nutrients. GLP-2 acts through a specific receptor, the GLP-2 receptor, mainly located in the gut and in the brain. Classically, GLP-2 is considered a trophic hormone involved in the maintenance of intestinal epithelial ...
Glucagon Like Peptide 2
4.2 Glucagon-like peptide 2 Glucagon-like peptide 2 (GLP-2) is secreted in the circulation in parallel with GLP-1 after a meal. It is a 33-amino acid proglucagon-derived peptide secreted from enteroendocrine L cells. GLP-2 increases the uptake of luminal nutrients such as sugars and lipids by enhancing the activity and expression of nutrients transporter (Drucker, 2005). Some recent studies ...
The high-specificity of this peptide for the intestinal tract and the development of degradation-resistant, long-acting GLP-2 receptor agonists have rapidly led to clinical implementation of GLP-2-based therapy for the treatment of patients with short bowel syndrome, with few reported side effects.
Overview of Glucagon Like Peptide 2 Physiology
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1).
Glucagon-like peptide-2 (GLP-2) has historically been defined by its primary role as an intestinal hormone essential for mucosal growth and epithelial barrier integrity. However, a surge of recent research has sparked a paradigm shift, recasting the GLP-2 receptor (GLP-2R) as a master orchestrator of communication between the gut, brain, and liver. This review synthesizes these advances ...
Key Details About Glucagon Like Peptide 2 Physiology
The gut hormone glucagon-like peptide-2 (GLP-2) has been shown to play pleotropic roles in the regulation of lipid handling in the intestine. Of note, GLP-2 exhibits unique actions on post-prandial lipid absorption and post-absorptive release of intestinally stored lipids.
Glucagon-like peptide 2 (GLP-2) is secreted in a nutrient-dependent manner from enteroendocrine cells throughout the gastrointestinal tract and is trophic to the intestinal epithelial mucosa. GLP-2 acts via stimulation of crypt cell proliferation and inhibition of cell death. GLP-2 also stimulates intestinal glucose transport, decreases mucosal permeability, and shows therapeutic efficacy in ...
